Recombinant Full Length Human LINC02870 Protein, GST-tagged

• Cat.No.: LINC02870-1789HF
• Product Overview: Human LINC02870 full-length ORF (NP_775812.1, 1 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 145 amino acids
• Description: LINC02870 (Long Intergenic Non-Protein Coding RNA 2870) is an RNA Gene, and is affiliated with the lncRNA class.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.8 kDa
• AA Sequence: MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTTRALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC02870 long intergenic non-protein coding RNA 2870 [ Homo sapiens (human) ]
• Official Symbol: LINC02870
• Synonyms: bA432J24.4; RP11-432J24.4
• Gene ID: 170393
• mRNA Refseq: NM_173541.2
• Protein Refseq: NP_775812.1
• UniProt ID: Q5T1B1