Recombinant Full Length Innexin-2(Inx-2) Protein, His-Tagged
Cat.No. : | RFL1099CF |
Product Overview : | Recombinant Full Length Innexin-2(inx-2) Protein (Q9U3K5) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MLGFFGPLYEQLVGMLRKQQGQLAFDTIDRVNAWFTPFVLVAMTLAISCKQYFGQPIKCW TPREFSGSWDGYVHDFCFIENTYFVPNGTEVTDEARGGRHINYYRWVPLVLLFQAAMFVL PYHLWNLFHKRTTINLKGSLRFFEGALKKLEPAQACESFAGEIWNRLSDIRNSSNKLYGF QATINYFLLKLGFIVNCILQMVLLKHFLDVDDYFWGFFHLWNVEFKGTAEKEDSIFPRIV LCDFKVRNLGQQHQHTVSCIMILNMIIEKLYICFYFWLIFVFVVTTAGMIHFAFQILFRR HSLIPTNLNNKNKMNPTRSHEFIKDYLNFDGCLLLTYVDAQFGAFRTSQVIDGLVHRFTN ELDSDSSAVTSLNEDHPERYVAFNTDTIPMDRYARKHHSLIEEVDGPSAPPANEEKKEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx-2 |
Synonyms | inx-2; opu-2; F08G12.10; Innexin-2; Protein opu-2 |
UniProt ID | Q9U3K5 |
◆ Recombinant Proteins | ||
EIF3E-1080HFL | Recombinant Full Length Human EIF3E Protein, C-Flag-tagged | +Inquiry |
SNRPC-5785M | Recombinant Rhesus macaque SNRPC Protein (Met1-Arg159), N-His tagged | +Inquiry |
Cbln3-2471M | Recombinant Mouse Cbln3 protein, His-SUMO-tagged | +Inquiry |
SGR-RS07310-679S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS07310 protein, His-tagged | +Inquiry |
LIAF-0378B | Recombinant Bacillus subtilis LIAF protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD1-5413HCL | Recombinant Human HOXD1 293 Cell Lysate | +Inquiry |
UROC1-484HCL | Recombinant Human UROC1 293 Cell Lysate | +Inquiry |
C3P1-1010HCL | Recombinant Human C3P1 cell lysate | +Inquiry |
CHTF18-355HCL | Recombinant Human CHTF18 cell lysate | +Inquiry |
NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All inx-2 Products
Required fields are marked with *
My Review for All inx-2 Products
Required fields are marked with *
0
Inquiry Basket