Recombinant Full Length Inner Membrane Protein Ybhq(Ybhq) Protein, His-Tagged
Cat.No. : | RFL34804EF |
Product Overview : | Recombinant Full Length Inner membrane protein ybhQ(ybhQ) Protein (P0AAW7) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQR HPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLA KDKKLHHLTSKHRVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhQ |
Synonyms | ybhQ; Z1010; ECs0869; Inner membrane protein YbhQ |
UniProt ID | P0AAW7 |
◆ Native Proteins | ||
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX32-6930HCL | Recombinant Human DHX32 293 Cell Lysate | +Inquiry |
NKD2-1198HCL | Recombinant Human NKD2 cell lysate | +Inquiry |
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
Vein-564H | Human Vein Lysate | +Inquiry |
RCL1-534HCL | Recombinant Human RCL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhQ Products
Required fields are marked with *
My Review for All ybhQ Products
Required fields are marked with *
0
Inquiry Basket