Recombinant Full Length Inner Membrane Protein Ybhq(Ybhq) Protein, His-Tagged
Cat.No. : | RFL21789SF |
Product Overview : | Recombinant Full Length Inner membrane protein ybhQ(ybhQ) Protein (P0AAW8) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQR HPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLA KDKKLHHLTSKHRVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhQ |
Synonyms | ybhQ; SF0741; S0782; Inner membrane protein YbhQ |
UniProt ID | P0AAW8 |
◆ Recombinant Proteins | ||
SMX5-9048Z | Recombinant Zebrafish SMX5 | +Inquiry |
RFL27675MF | Recombinant Full Length Mouse Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged | +Inquiry |
flavivirus polyprotein gene-44D | Recombinant Dengue flavivirus polyprotein gene protein, His-tagged | +Inquiry |
CELA2A-1329R | Recombinant Rat CELA2A Protein | +Inquiry |
NCR1-0526H | Active Recombinant Human NCR1 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
JMJD6-5101HCL | Recombinant Human JMJD6 293 Cell Lysate | +Inquiry |
PPARGC1B-2984HCL | Recombinant Human PPARGC1B 293 Cell Lysate | +Inquiry |
CMBL-7421HCL | Recombinant Human CMBL 293 Cell Lysate | +Inquiry |
RNF34-2279HCL | Recombinant Human RNF34 293 Cell Lysate | +Inquiry |
MICU1-146HCL | Recombinant Human MICU1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ybhQ Products
Required fields are marked with *
My Review for All ybhQ Products
Required fields are marked with *
0
Inquiry Basket