Recombinant Full Length Inner Membrane Abc Transporter Permease Protein Yejb(Yejb) Protein, His-Tagged
Cat.No. : | RFL17647EF |
Product Overview : | Recombinant Full Length Inner membrane ABC transporter permease protein yejB(yejB) Protein (P0AFU1) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGNAGVLPGAGGEGVRA SHAQTGVGNISDSNYRGGRGLDPEVIAEITHRYGFDKPIHERYFKMLWDYIRFDFGDSLF RSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYAI PAFLFAILLIVFFAGGSYFDLFPLRGLVSANFDSLPWYQKITDYLWHITLPVLATVIGGF AALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFT GSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRID FEGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yejB |
Synonyms | yejB; Z3437; ECs3070; Inner membrane ABC transporter permease protein YejB |
UniProt ID | P0AFU1 |
◆ Recombinant Proteins | ||
COL7A1-1006HFL | Recombinant Full Length Human COL7A1 Protein, C-Flag-tagged | +Inquiry |
TXNDC17-903Z | Recombinant Zebrafish TXNDC17 | +Inquiry |
SAP111A-016-3970S | Recombinant Staphylococcus aureus (strain: WBG8366, other: ST78-MRSA-IVa (2B)) SAP111A_016 protein, His-tagged | +Inquiry |
OLFML3-6015HFL | Recombinant Full Length Human OLFML3, Flag-tagged | +Inquiry |
SLC25A10-4240R | Recombinant Rhesus monkey SLC25A10 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRB14-5756HCL | Recombinant Human GRB14 293 Cell Lysate | +Inquiry |
PIP4K2A-3175HCL | Recombinant Human PIP4K2A 293 Cell Lysate | +Inquiry |
GBP5-5997HCL | Recombinant Human GBP5 293 Cell Lysate | +Inquiry |
DDR1-001HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yejB Products
Required fields are marked with *
My Review for All yejB Products
Required fields are marked with *
0
Inquiry Basket