Recombinant Full Length Influenza A Virus Neuraminidase(Na) Protein, His-Tagged
Cat.No. : | RFL26357IF |
Product Overview : | Recombinant Full Length Influenza A virus Neuraminidase(NA) Protein (Q595Z2) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Turkey/Canada/1963 H6N8) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MNPNQKIITIGSVSLGLVVLNILLHIVSITITVLVLPGNGNNGSCNETVIREYNETVRIE KIIQWHNTNVIEYIERPESDHFMNNTEPLCDAKGFAPFSKDNGIRIGSRGHVFVIREPFV SCSPTECRTFFLTQGSLLNDKHSNGTVKDRSPYRTLMSVEIGQSPNVYQARFEAVAWSAT ACHDGKKWMTIGVTGPDAKAVAVVHYGGIPTDVINSWAGDILRTQESSCTCIQGECYWVM TDGPANRQAQYRAFKAKQGKIIGQTEISFNGGHIEECSCYPNEGKVECVCRDNWTGTNRP VLVISSDLSYRVGYLCAGLPSDTPRGEDSQFTGSCTSPMGNQGYGVKGFGFRQGNDVWMG RTISRTSRSGFEILKVRNGWIQNSKEQIKRQVVVDNLNWSGYSGSFTLPVELTRRNCLVP CFWVEMIRGKPEEKTIWTSSSSIVMCGVDHEIADWSWHDGAILPFDIDKM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NA |
Synonyms | NA; Neuraminidase |
UniProt ID | Q595Z2 |
◆ Recombinant Proteins | ||
CCDC149-5202H | Recombinant Human CCDC149 Protein, GST-tagged | +Inquiry |
RFL23240XF | Recombinant Full Length Xenopus Laevis Upf0767 Protein C1Orf212 Homolog B Protein, His-Tagged | +Inquiry |
TAGAP-16406M | Recombinant Mouse TAGAP Protein | +Inquiry |
CSAG1-3339H | Recombinant Human CSAG1 Protein, MYC/DDK-tagged | +Inquiry |
SP2-4418R | Recombinant Rhesus monkey SP2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPTX2-1213HCL | Recombinant Human NPTX2 cell lysate | +Inquiry |
BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
OAS3-3613HCL | Recombinant Human OAS3 293 Cell Lysate | +Inquiry |
PAICS-3461HCL | Recombinant Human PAICS 293 Cell Lysate | +Inquiry |
LRP10-1639HCL | Recombinant Human LRP10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NA Products
Required fields are marked with *
My Review for All NA Products
Required fields are marked with *
0
Inquiry Basket