Recombinant Full Length Influenza A Virus Neuraminidase(Na) Protein, His-Tagged
Cat.No. : | RFL17550IF |
Product Overview : | Recombinant Full Length Influenza A virus Neuraminidase(NA) Protein (Q30NP8) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Beijing/39/1975 H3N2) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MNPNQKIITIGSVSLTIATICFLMQIAILVTTVTLHFKQYECDSPANKQVMPCEPIIIER NITEIVYLTNTTIEKEICPKLVEYRNWSKPQCKITGFAPFSKDNSIRLSAGGDIWVTREP YVSCDPGKCYQFALGQGTTLDNKHSNDTIHDRTPHRTLLMNELGVPFHLGTRQVCIAWSS SSCHDGKAWLHVCVTGYDKNATASFIYDGRLVDSIGSWSQNILRTQESECVCINGTCTVV MTDGSASGRADTKILFIEEGKIVHISPLSGSAQHVEECSCYPRYPGVRCICRDNWKGSNR PVVDINVKDYSIDSSYVCSGLVGDTPRNNDRSSSSYCRNPNNEKGTHGVKGWAFDDGNDV WMGRTISEDSRSGYETFKVIGGWSTPNSKLQINRQVIVDSDNRSGYSGIFSVEGKSCINR CFYVELIRGREQETRVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NA |
Synonyms | NA; Neuraminidase |
UniProt ID | Q30NP8 |
◆ Recombinant Proteins | ||
G0S2-5096HF | Recombinant Full Length Human G0S2 Protein, GST-tagged | +Inquiry |
Csrp1-6916M | Recombinant Mouse CSRP1 protein(Met1-Glu193), His-tagged | +Inquiry |
ZFP637-19015M | Recombinant Mouse ZFP637 Protein | +Inquiry |
IGLL1-107H | Recombinant Human IGLL1 protein, T7/His-tagged | +Inquiry |
SUSD4-8886M | Recombinant Mouse SUSD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIPF4-244HCL | Recombinant Human YIPF4 293 Cell Lysate | +Inquiry |
ELP2-6616HCL | Recombinant Human ELP2 293 Cell Lysate | +Inquiry |
LYZL2-001HCL | Recombinant Human LYZL2 cell lysate | +Inquiry |
MYL12B-4029HCL | Recombinant Human MYL12B 293 Cell Lysate | +Inquiry |
AMMECR1-8880HCL | Recombinant Human AMMECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NA Products
Required fields are marked with *
My Review for All NA Products
Required fields are marked with *
0
Inquiry Basket