Recombinant Full Length Illicium Oligandrum Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL30721IF |
Product Overview : | Recombinant Full Length Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic Protein (A6MN00) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Illicium oligandrum (Star anise) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFSRSESSKEFYGLIWLLVPIFTPVSGILIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIRLFSVGPSIAVISILLSYSVIPFGY RLIIADISIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVL SISLRLSNSSSTVDIVEAQSKYGFCGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEE LVAGYQTEYSGIKSGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYISIPELFGINKTGG VFGSTIGILITLAKAYLFLFVPITTRWTLPRMRMDQLLNLGWKFLLPIALGNLLLTTSSQ LLSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | A6MN00 |
◆ Recombinant Proteins | ||
POLRMT-27748TH | Recombinant Human POLRMT, His-tagged | +Inquiry |
GJB1-4926H | Recombinant Human GJB1 Protein, GST-tagged | +Inquiry |
RFL13539NF | Recombinant Full Length Neosartorya Fumigata Solute Carrier Family 25 Member 38 Homolog(Afua_4G12340) Protein, His-Tagged | +Inquiry |
TAS2R125-16454M | Recombinant Mouse TAS2R125 Protein | +Inquiry |
NEU3.3-4751Z | Recombinant Zebrafish NEU3.3 | +Inquiry |
◆ Native Proteins | ||
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG1A-1364RCL | Recombinant Rat REG1A cell lysate | +Inquiry |
GNGT1-722HCL | Recombinant Human GNGT1 cell lysate | +Inquiry |
WDR16-1924HCL | Recombinant Human WDR16 cell lysate | +Inquiry |
POLR3H-3022HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry |
CAMK4-001MCL | Recombinant Mouse CAMK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket