Recombinant Full Length Ictalurid Herpesvirus 1 Putative Membrane Protein Orf6(Orf6) Protein, His-Tagged
Cat.No. : | RFL20088IF |
Product Overview : | Recombinant Full Length Ictalurid herpesvirus 1 Putative membrane protein ORF6(ORF6) Protein (Q00102) (1-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ictalurid herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-138) |
Form : | Lyophilized powder |
AA Sequence : | MNSLTIIFLLSGLTAYHAVLADGTGSSESVTAGDSGVVVLVMIGALLTLLMTIPIIGLFG IYVRTRASIEEMRGILMQIHLRLITGDQRSNRGDVELGAGASLLTISSQPPSYAEALLME PVEPQQQEGVPLEAEIRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF6 |
Synonyms | ORF6; Putative membrane protein ORF6 |
UniProt ID | Q00102 |
◆ Recombinant Proteins | ||
NMU-5254C | Recombinant Chicken NMU | +Inquiry |
RFL24748HF | Recombinant Full Length Human Transmembrane Protein 169(Tmem169) Protein, His-Tagged | +Inquiry |
HSPB1-2549H | Recombinant Human HSPB1 protein(61-200 aa), C-His-tagged | +Inquiry |
MOAP1-926H | Recombinant Human MOAP1, His-tagged | +Inquiry |
FAM3C-2664H | Recombinant Human FAM3C Protein (Gln25-Asp227), C-His tagged | +Inquiry |
◆ Native Proteins | ||
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK4-4493HCL | Recombinant Human MAPK4 293 Cell Lysate | +Inquiry |
TRIM43-774HCL | Recombinant Human TRIM43 293 Cell Lysate | +Inquiry |
ACTRT3-8682HCL | Recombinant Human ARPM1 293 Cell Lysate | +Inquiry |
TMEM183A-679HCL | Recombinant Human TMEM183A lysate | +Inquiry |
GRHPR-5749HCL | Recombinant Human GRHPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF6 Products
Required fields are marked with *
My Review for All ORF6 Products
Required fields are marked with *
0
Inquiry Basket