Recombinant Full Length Huperzia Lucidula Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged
Cat.No. : | RFL18995HF |
Product Overview : | Recombinant Full Length Huperzia lucidula Photosystem II reaction center protein Z(psbZ) Protein (Q5SD09) (1-62aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-62) |
Form : | Lyophilized powder |
AA Sequence : | MTIAFQLAVFASIAIPFILVIGVPVVLASPDGWSSSRNVVFSGASSWIGLVFLVGILNSL IS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbZ |
Synonyms | psbZ; Photosystem II reaction center protein Z; PSII-Z |
UniProt ID | Q5SD09 |
◆ Recombinant Proteins | ||
TMEM126A-16903M | Recombinant Mouse TMEM126A Protein | +Inquiry |
MMP17-5601M | Recombinant Mouse MMP17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spike-02D | Recombinant 2019-nCoV S1+S2 ECD(Y453F, 69-70del, I692V) Protein, His-tagged | +Inquiry |
RHO-33H | Recombinant Human RHO protein, His-TRxA-tagged | +Inquiry |
STRN-16175M | Recombinant Mouse STRN Protein | +Inquiry |
◆ Native Proteins | ||
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
ELN-01H | Active Native Human ELN Protein | +Inquiry |
F2-275B | Active Native Bovine α-Thrombin-DFP | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KA6-674HCL | Recombinant Human RPS6KA6 cell lysate | +Inquiry |
MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
NT5E-2491MCL | Recombinant Mouse NT5E cell lysate | +Inquiry |
CXCL14-7169HCL | Recombinant Human CXCL14 293 Cell Lysate | +Inquiry |
TAF13-1275HCL | Recombinant Human TAF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbZ Products
Required fields are marked with *
My Review for All psbZ Products
Required fields are marked with *
0
Inquiry Basket