Recombinant Full Length Cyanothece Sp. Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged
Cat.No. : | RFL17778CF |
Product Overview : | Recombinant Full Length Cyanothece sp. Photosystem II reaction center protein Z(psbZ) Protein (B7KCV9) (1-62aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-62) |
Form : | Lyophilized powder |
AA Sequence : | MSIVFQIALAALVFFSFVMVIGVPFAYAAPQYWDQSKPLLWVGSGIWTILVIVVAVLNFF VI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbZ |
Synonyms | psbZ; PCC7424_3261; Photosystem II reaction center protein Z; PSII-Z |
UniProt ID | B7KCV9 |
◆ Recombinant Proteins | ||
RFL10598MF | Recombinant Full Length Mycoplasma Genitalium Uncharacterized Protein Mg243 (Mg243) Protein, His-Tagged | +Inquiry |
HIST1H2BP-4198M | Recombinant Mouse HIST1H2BP Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR3B-1473H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
SE1342-3194S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1342 protein, His-tagged | +Inquiry |
ELANE-3398H | Recombinant Human ELANE protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-340G | Native Goat IgG | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL4B-7181HCL | Recombinant Human CUL4B 293 Cell Lysate | +Inquiry |
HSPH1-5338HCL | Recombinant Human HSPH1 293 Cell Lysate | +Inquiry |
RARRES1-1470HCL | Recombinant Human RARRES1 cell lysate | +Inquiry |
NLRP12-3801HCL | Recombinant Human NLRP12 293 Cell Lysate | +Inquiry |
NKPD1-3816HCL | Recombinant Human NKPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbZ Products
Required fields are marked with *
My Review for All psbZ Products
Required fields are marked with *
0
Inquiry Basket