Recombinant Full Length Huperzia Lucidula Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL3990HF |
Product Overview : | Recombinant Full Length Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q5SCZ2) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MVINKNLEEQVIDLFYKLGFPKDLFGFIWIITPILTYTLGVTIGISVIVWLERKISAGVQ QRIGPEHAGPLGIIQALADGAKLLSKEDIIPSRGDSFLFNVGPVMVVVPVFLSYLVIPLG HGIILADLDIGVFFWIAVSSVAPLGLLTAGYGSNNKYSSLGGLRAAAQSISYEIPLALCV LSVSPLSNSLSTVDIVEAQSKYGFWGWNSWRQPIGFVAFFISSLAECERLPFDLPEAEEE LVAGYQTEYSGIKFGLFYVASHPNLLTSSLSATILYLGGWNSPIPFLFLPKFDRLGWNST DETSEVISITIAIIITLAKAYSFLFISIATRWTLPRVRMDQLLDLGWKSLLPVALGNSLP TASFQLSSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q5SCZ2 |
◆ Recombinant Proteins | ||
KDR27321H | Recombinant Human HIS-KDR (814-1171) Deletion (940-990) Protein | +Inquiry |
BAD-333R | Recombinant Rhesus Macaque BAD Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIA-5690P | Recombinant Pig PPIA protein, His-tagged | +Inquiry |
CHRNA3-2691H | Recombinant Human CHRNA3 Protein (32-240 aa), His-tagged | +Inquiry |
MTA2-5763M | Recombinant Mouse MTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Alb-503R | Native Rat Alb Protein | +Inquiry |
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMOTL1-71HCL | Recombinant Human AMOTL1 cell lysate | +Inquiry |
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
CGB5-001HCL | Recombinant Human CGB5 cell lysate | +Inquiry |
SEPSECS-1968HCL | Recombinant Human SEPSECS 293 Cell Lysate | +Inquiry |
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket