Recombinant Full Length Human wild-type Tau 2N4R

• Cat.No.: Tau dGAE-01H
• Product Overview: Recombinant Human Tau dGAE Monomers (297-391 aa) without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 297-391 aa
• Description: This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer''s disease, Pick''s disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.
• Tag: Non
• Molecular Mass: 10.165 kDa
• AA Sequence: IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
• Purity: > 95%
• Applications: WB, SDS PAGE, In vitro Assay
• Storage: Store at -80 centigrade.
• Storage Buffer: 10mM PB pH 7.4, 10mM DTT
• Concentration: 2 mg/mL or 5 mg/mL
• Shipping: Dry Ice. Product will be shipped separately from other products purchased in the same order.

Gene Information

• Gene Name: MAPT microtubule associated protein tau [ Homo sapiens (human) ]
• Official Symbol: MAPT
• Synonyms: MAPT; microtubule associated protein tau; TAU; FTD1; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6; microtubule-associated protein tau; G protein beta1/gamma2 subunit-interacting factor 1; PHF-tau; Tau-derived paired helical filament hexapeptide; neurofibrillary tangle protein; paired helical filament-tau; protein phosphatase 1, regulatory subunit 103
• Gene ID: 4137
• mRNA Refseq: NM_016835
• Protein Refseq: NP_058519
• MIM: 157140
• UniProt ID: P10636