Recombinant Full Length Human VSX2 Protein, GST-tagged

• Cat.No.: VSX2-1838HF
• Product Overview: Human CHX10 full-length ORF ( NP_878314.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 361 amino acids
• Description: This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009]
• Molecular Mass: 65.8 kDa
• AA Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: VSX2 visual system homeobox 2 [ Homo sapiens ]
• Official Symbol: VSX2
• Synonyms: VSX2; visual system homeobox 2; C elegans ceh 10 homeo domain containing homolog , ceh 10 homeo domain containing homolog (C. elegans) , ceh 10 homeodomain containing homolog (C. elegans) , CHX10, HOX10; RET1; homeobox protein CHX10; ceh-10 homeodomain-containing homolog; ceh-10 homeo domain containing homolog; CHX10; HOX10; MCOP2; MCOPCB3
• Gene ID: 338917
• mRNA Refseq: NM_182894
• Protein Refseq: NP_878314
• MIM: 142993
• UniProt ID: P58304