Recombinant Full Length Human VPS25 Protein, GST-tagged

• Cat.No.: VPS25-6255HF
• Product Overview: Human MGC10540 full-length ORF ( AAH06282, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.1 kDa
• Protein length: 176 amino acids
• AA Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS25
• Synonyms: VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein sorting 25 (yeast); vacuolar protein-sorting-associated protein 25; DERP9; EAP20; MGC10540; ESCRT-II complex subunit VPS25; ELL-associated protein of 20 kDa; dermal papilla-derived protein 9; FAP20
• Gene ID: 84313
• mRNA Refseq: NM_032353
• Protein Refseq: NP_115729
• MIM: 610907
• UniProt ID: Q9BRG1