Recombinant Full Length Human VIT Protein, GST-tagged

• Cat.No.: VIT-1802HF
• Product Overview: Recombinant Human VIT(1 a.a. - 203 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 203 amino acids
• Description: This gene encodes an extracellular matrix (ECM) protein. The protein may be associated with cell adhesion and migration. High levels of expression of the protein in specific parts of the brain suggest its likely role in neural development.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.2 kDa
• AA Sequence: MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGKCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: VIT vitrin [ Homo sapiens ]
• Official Symbol: VIT
• Synonyms: VIT; vitrin; MGC70561; MGC149746; DKFZp313L1517
• Gene ID: 5212
• mRNA Refseq: NM_001177969
• Protein Refseq: NP_001171440
• MIM: 617693
• UniProt ID: Q6UXI7