Recombinant Full Length Human Visual Pigment-Like Receptor Peropsin(Rrh) Protein, His-Tagged
Cat.No. : | RFL2802HF |
Product Overview : | Recombinant Full Length Human Visual pigment-like receptor peropsin(RRH) Protein (O14718) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RRH |
Synonyms | RRH; Visual pigment-like receptor peropsin |
UniProt ID | O14718 |
◆ Recombinant Proteins | ||
RFL2407BF | Recombinant Full Length Burkholderia Vietnamiensis Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
RNF146-10227Z | Recombinant Zebrafish RNF146 | +Inquiry |
FAM162A-5499Z | Recombinant Zebrafish FAM162A | +Inquiry |
PCBP3-3782H | Recombinant Human PCBP3 protein, His-tagged | +Inquiry |
AYP1020-RS07170-4880S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS07170 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB104A-6988HCL | Recombinant Human DEFB104A 293 Cell Lysate | +Inquiry |
Heart-796G | Guinea Pig Heart Membrane Lysate, Total Protein | +Inquiry |
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
RBM10-2482HCL | Recombinant Human RBM10 293 Cell Lysate | +Inquiry |
Ileum-673H | Hamster Ileum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRH Products
Required fields are marked with *
My Review for All RRH Products
Required fields are marked with *
0
Inquiry Basket