Recombinant Full Length Human VCAM1 Protein, C-Flag-tagged
Cat.No. : | VCAM1-1473HFL |
Product Overview : | Recombinant Full Length Human VCAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.7 kDa |
AA Sequence : | MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration |
Full Length : | Full L. |
Gene Name | VCAM1 vascular cell adhesion molecule 1 [ Homo sapiens (human) ] |
Official Symbol | VCAM1 |
Synonyms | CD106; INCAM-100 |
Gene ID | 7412 |
mRNA Refseq | NM_001078.4 |
Protein Refseq | NP_001069.1 |
MIM | 192225 |
UniProt ID | P19320 |
◆ Recombinant Proteins | ||
RFL3791RF | Recombinant Full Length Rat Vascular Cell Adhesion Protein 1(Vcam1) Protein, His-Tagged | +Inquiry |
VCAM1-01H | Active Recombinant Human VCAM1 Protein | +Inquiry |
VCAM1-2325H | Active Recombinant Human VCAM1 protein, His-tagged | +Inquiry |
VCAM1-68H | Active Recombinant Human VCAM1 Protein, His-tagged, Bioactivity Validated | +Inquiry |
Vcam1-2313MAF647 | Recombinant Mouse Vcam1 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAM1-2094MCL | Recombinant Mouse VCAM1 cell lysate | +Inquiry |
VCAM1-2653MCL | Recombinant Mouse VCAM1 cell lysate | +Inquiry |
VCAM1-2439HCL | Recombinant Human VCAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VCAM1 Products
Required fields are marked with *
My Review for All VCAM1 Products
Required fields are marked with *
0
Inquiry Basket