Recombinant Full Length Human VASH1 Protein, His tagged

• Cat.No.: VASH1-3096HFL
• Product Overview: Recombinant Full Length Human VASH1 Protein (2-365 aa) with C-His tag was expressed in Baculovirus-Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 2-365 aa
• Description: Enables actin binding activity and metallocarboxypeptidase activity. Involved in negative regulation of angiogenesis; negative regulation of blood vessel endothelial cell migration; and proteolysis. Acts upstream of or within several processes, including negative regulation of endothelial cell proliferation; negative regulation of lymphangiogenesis; and regulation of cellular senescence. Located in apical part of cell; endoplasmic reticulum; and extracellular space. Implicated in liver cirrhosis and portal hypertension. Biomarker of liver cirrhosis.
• Source: Insect cells
• Species: Human
• Tag: C-His
• Molecular Weight: 42 kDa
• AA Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRVHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 4% Trehalose, 0.5% SKL
• Concentration: 1 mg/mL by Bradford

Gene Information

• Gene Name: VASH1 vasohibin 1 [ Homo sapiens (human) ]
• Official Symbol: VASH1
• Synonyms: VASH1; vasohibin 1; KIAA1036; vasohibin-1
• Gene ID: 22846
• mRNA Refseq: NM_014909
• Protein Refseq: NP_055724
• MIM: 609011
• UniProt ID: Q7L8A9