Recombinant Full Length Human V-Type Proton Atpase Subunit E 2(Atp6V0E2) Protein, His-Tagged
Cat.No. : | RFL14649HF |
Product Overview : | Recombinant Full Length Human V-type proton ATPase subunit e 2(ATP6V0E2) Protein (Q8NHE4) (1-81aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-81) |
Form : | Lyophilized powder |
AA Sequence : | MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6V0E2 |
Synonyms | ATP6V0E2; ATP6V0E2L; C7orf32; V-type proton ATPase subunit e 2; V-ATPase subunit e 2; Lysosomal 9 kDa H(+-transporting ATPase V0 subunit e2; Vacuolar proton pump subunit e 2 |
UniProt ID | Q8NHE4 |
◆ Recombinant Proteins | ||
ATP6V0E2-2157M | Recombinant Mouse ATP6V0E2 Protein | +Inquiry |
ATP6V0E2-889R | Recombinant Rat ATP6V0E2 Protein | +Inquiry |
RFL29464BF | Recombinant Full Length Bovine V-Type Proton Atpase Subunit E 2(Atp6V0E2) Protein, His-Tagged | +Inquiry |
ATP6V0E2-545R | Recombinant Rat ATP6V0E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14649HF | Recombinant Full Length Human V-Type Proton Atpase Subunit E 2(Atp6V0E2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V0E2 Products
Required fields are marked with *
My Review for All ATP6V0E2 Products
Required fields are marked with *
0
Inquiry Basket