Recombinant Full Length Human USP39 Protein, C-Flag-tagged
Cat.No. : | USP39-1264HFL |
Product Overview : | Recombinant Full Length Human USP39 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable thiol-dependent deubiquitinase and zinc ion binding activity. Involved in spliceosomal complex assembly. Located in nucleoplasm. Part of U4/U6 x U5 tri-snRNP complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.2 kDa |
AA Sequence : | MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFV RVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCG KYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAK LSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGEL MRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQ GSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA KFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQA VHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET NQQGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | USP39 ubiquitin specific peptidase 39 [ Homo sapiens (human) ] |
Official Symbol | USP39 |
Synonyms | 65K; SAD1; CGI-21; HSPC332; SNRNP65 |
Gene ID | 10713 |
mRNA Refseq | NM_006590.4 |
Protein Refseq | NP_006581.2 |
MIM | 611594 |
UniProt ID | Q53GS9 |
◆ Recombinant Proteins | ||
USP39-413H | Recombinant Human USP39 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
USP39-9964M | Recombinant Mouse USP39 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP39-1264HFL | Recombinant Full Length Human USP39 Protein, C-Flag-tagged | +Inquiry |
USP39-4941R | Recombinant Rhesus Macaque USP39 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP39-5005Z | Recombinant Zebrafish USP39 | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP39-457HCL | Recombinant Human USP39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP39 Products
Required fields are marked with *
My Review for All USP39 Products
Required fields are marked with *
0
Inquiry Basket