Recombinant Full Length Human USP21 Protein, C-Flag-tagged
Cat.No. : | USP21-1274HFL |
Product Overview : | Recombinant Full Length Human USP21 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.5 kDa |
AA Sequence : | MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPGSGPNPMLRPLPPRPGLPDERLKKLELGR GRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLRPMGIALGGHRGTGELGAALS RLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASHGSFHMISARSSEPFYSDDKMAHHTLLLGSG HVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNP TRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELS DDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLG DFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE PPRCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | USP21 ubiquitin specific peptidase 21 [ Homo sapiens (human) ] |
Official Symbol | USP21 |
Synonyms | USP16; USP23 |
Gene ID | 27005 |
mRNA Refseq | NM_012475.5 |
Protein Refseq | NP_036607.3 |
MIM | 604729 |
UniProt ID | Q9UK80 |
◆ Recombinant Proteins | ||
USP21-215H | Recombinant human USP21 protein, Myc/DDK-tagged | +Inquiry |
USP21-151H | Recombinant Human USP21, His-SUMO-tagged | +Inquiry |
USP21-1274HFL | Recombinant Full Length Human USP21 Protein, C-Flag-tagged | +Inquiry |
USP21-2324H | Recombinant Human USP21 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP21-6474R | Recombinant Rat USP21 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP21-465HCL | Recombinant Human USP21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP21 Products
Required fields are marked with *
My Review for All USP21 Products
Required fields are marked with *
0
Inquiry Basket