Recombinant Full Length Human Uncharacterized Protein Cxorf59(Cxorf59) Protein, His-Tagged
Cat.No. : | RFL15281HF |
Product Overview : | Recombinant Full Length Human Uncharacterized protein CXorf59(CXorf59) Protein (Q8N9S7) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MAIHLDKQNIILKNDKDEYLKKTRDGVLPPYQDAKPPSPASIKKTYTTSKFNDAEPAKGN LFIGVEVLPENLHLDESETSEEDHGSLEKEKYEQFLSLEEGTKAHYFFEKVVNAAQTWFS LFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKYNKTIYDVLLHLSGKM PPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEI MSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMP PICVQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIWKNCHKDVIPSERWIVNF DKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDVEIQ VCLRVFPKEMDAGVSGLRKEDMPSVWVVTIRLAVAVARTKRQKKGDIQFACFFVCLFFFI FVVISFSLWSRMHFFLLLPLDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein CXorf59(CXorf59) |
UniProt ID | Q8N9S7 |
◆ Recombinant Proteins | ||
LRRC26-9260M | Recombinant Mouse LRRC26 Protein | +Inquiry |
ACTA2-676HFL | Active Recombinant Full Length Human ACTA2 Protein, C-Flag-tagged | +Inquiry |
LARP4B-4993M | Recombinant Mouse LARP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDM-3265H | Recombinant Human ALDM, His-tagged | +Inquiry |
CD28-1605H | Recombinant Human CD28 Protein (Met1-Pro152), C-Fc tagged | +Inquiry |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
IgM-01C | Native Cow IgM Protein | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB14-2627HCL | Recombinant Human RAB14 293 Cell Lysate | +Inquiry |
SCN3B-1454HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
HA-2187HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
MARCH2-4472HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein CXorf59(CXorf59) Products
Required fields are marked with *
My Review for All Uncharacterized protein CXorf59(CXorf59) Products
Required fields are marked with *
0
Inquiry Basket