Recombinant Full Length Human Udp-Glucuronosyltransferase 1-10(Ugt1A10) Protein, His-Tagged
Cat.No. : | RFL16034HF |
Product Overview : | Recombinant Full Length Human UDP-glucuronosyltransferase 1-10(UGT1A10) Protein (Q9HAW8) (26-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-530) |
Form : | Lyophilized powder |
AA Sequence : | GKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCTVKTYSTSYTLED QNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAV FLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKE RVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPV MPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGK IPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPM VMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHK DRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFK CCAYGYRKCLGKKGRVKKAHKSKTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT1A10 |
Synonyms | UGT1A10; GNT1; UGT1; UDP-glucuronosyltransferase 1A10; UGT1A10; UDP-glucuronosyltransferase 1-10; UDPGT 1-10; UGT1*10; UGT1-10; UGT1.10; UDP-glucuronosyltransferase 1-J; UGT-1J; UGT1J |
UniProt ID | Q9HAW8 |
◆ Recombinant Proteins | ||
UGT1A10-101H | Active Recombinant Human UGT1A10 Protein | +Inquiry |
UGT1A10-2309H | Recombinant Human UGT1A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT1A10-6359H | Recombinant Human UGT1A10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL16034HF | Recombinant Full Length Human Udp-Glucuronosyltransferase 1-10(Ugt1A10) Protein, His-Tagged | +Inquiry |
UGT1A10-1394HFL | Recombinant Full Length Human UGT1A10 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT1A10 Products
Required fields are marked with *
My Review for All UGT1A10 Products
Required fields are marked with *
0
Inquiry Basket