Recombinant Full Length Human UCN3 Protein, GST-tagged

• Cat.No.: UCN3-6867HF
• Product Overview: Human UCN3 full-length ORF ( NP_444277.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 161 amino acids
• Description: This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells. This hormone is an endogenous ligand for corticotropin-releasing factor receptor 2 and may regulate insulin secretion in response to plasma glucose levels. Patients with type 2 diabetes exhibit reduced levels of the encoded protein in beta cells. In the brain, the encoded protein may be responsible for the effects of stress on appetite.
• Molecular Mass: 44.4 kDa
• AA Sequence: MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
• Applications: ELISA
  WB (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UCN3 urocortin 3 [ Homo sapiens (human) ]
• Official Symbol: UCN3
• Synonyms: UCN3; urocortin 3; SCP; SPC; UCNIII; urocortin-3; prepro-urocortin 3; stresscopin; ucn III; urocortin III
• Gene ID: 114131
• mRNA Refseq: NM_053049
• Protein Refseq: NP_444277
• MIM: 605901
• UniProt ID: Q969E3