Recombinant Full Length Human UBE2T Protein, C-Flag-tagged
Cat.No. : | UBE2T-1041HFL |
Product Overview : | Recombinant Full Length Human UBE2T Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | UBE2T ubiquitin conjugating enzyme E2 T [ Homo sapiens (human) ] |
Official Symbol | UBE2T |
Synonyms | FANCT; PIG50; HSPC150 |
Gene ID | 29089 |
mRNA Refseq | NM_014176.4 |
Protein Refseq | NP_054895.1 |
MIM | 610538 |
UniProt ID | Q9NPD8 |
◆ Recombinant Proteins | ||
UBE2T-141H | Recombinant Human UBE2T | +Inquiry |
UBE2T-9839M | Recombinant Mouse UBE2T Protein, His (Fc)-Avi-tagged | +Inquiry |
Ube2t-6799M | Recombinant Mouse Ube2t Protein, Myc/DDK-tagged | +Inquiry |
UBE2T-561H | Recombinant Human UBE2T Protein (Met1-Val197), His-tagged | +Inquiry |
UBE2T-3546H | Recombinant Human UBE2T, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2T-561HCL | Recombinant Human UBE2T 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2T Products
Required fields are marked with *
My Review for All UBE2T Products
Required fields are marked with *
0
Inquiry Basket