Recombinant Full Length Human UBASH3B Protein, C-Flag-tagged
Cat.No. : | UBASH3B-631HFL |
Product Overview : | Recombinant Full Length Human UBASH3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.5 kDa |
AA Sequence : | MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAAC DWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKV DALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQ LHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDF IFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENH LKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEI ISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPIL PLTHGPTGGFNWRETLLQETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS |
Full Length : | Full L. |
Gene Name | UBASH3B ubiquitin associated and SH3 domain containing B [ Homo sapiens (human) ] |
Official Symbol | UBASH3B |
Synonyms | p70; STS1; STS-1; TULA2; TULA-2 |
Gene ID | 84959 |
mRNA Refseq | NM_032873.5 |
Protein Refseq | NP_116262.2 |
MIM | 609201 |
UniProt ID | Q8TF42 |
◆ Recombinant Proteins | ||
UBASH3B-5051R | Recombinant Rhesus monkey UBASH3B Protein, His-tagged | +Inquiry |
UBASH3B-4864R | Recombinant Rhesus Macaque UBASH3B Protein, His (Fc)-Avi-tagged | +Inquiry |
UBASH3B-631HFL | Recombinant Full Length Human UBASH3B Protein, C-Flag-tagged | +Inquiry |
UBASH3B-1864H | Recombinant Human UBASH3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBASH3B-2294H | Recombinant Human UBASH3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBASH3B-2142HCL | Recombinant Human UBASH3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBASH3B Products
Required fields are marked with *
My Review for All UBASH3B Products
Required fields are marked with *
0
Inquiry Basket