Recombinant Full Length Human TUBA1A Protein, C-Flag-tagged
Cat.No. : | TUBA1A-194HFL |
Product Overview : | Recombinant Full Length Human TUBA1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulins. The genes encoding these microtubule constituents belong to the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes, which are highly conserved among species. This gene encodes alpha tubulin and is highly similar to the mouse and rat Tuba1 genes. Northern blot studies have shown that the gene expression is predominantly found in morphologically differentiated neurologic cells. This gene is one of three alpha-tubulin genes in a cluster on chromosome 12q. Mutations in this gene cause lissencephaly type 3 (LIS3) - a neurological condition characterized by microcephaly, intellectual disability, and early-onset epilepsy caused by defective neuronal migration. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50 kDa |
AA Sequence : | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGVDSVEGEGEEEGEEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Gap junction, Pathogenic Escherichia coli infection |
Full Length : | Full L. |
Gene Name | TUBA1A tubulin alpha 1a [ Homo sapiens (human) ] |
Official Symbol | TUBA1A |
Synonyms | B-ALPHA-1; LIS3; TUBA3 |
Gene ID | 7846 |
mRNA Refseq | NM_006009.4 |
Protein Refseq | NP_006000.2 |
MIM | 602529 |
UniProt ID | Q71U36 |
◆ Recombinant Proteins | ||
TUBA1A-16H | Recombinant Human TUBA1A protein, MYC/DDK-tagged | +Inquiry |
TUBA1A-194HFL | Recombinant Full Length Human TUBA1A Protein, C-Flag-tagged | +Inquiry |
TUBA1A-6354R | Recombinant Rat TUBA1A Protein | +Inquiry |
TUBA1A-9752M | Recombinant Mouse TUBA1A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBA1A-17608M | Recombinant Mouse TUBA1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBA1A Products
Required fields are marked with *
My Review for All TUBA1A Products
Required fields are marked with *
0
Inquiry Basket