Recombinant Full Length Human TRMT13 Protein, GST-tagged

Cat.No. : TRMT13-2882HF
Product Overview : Human TRMT13 full-length ORF (NP_061956.1, 1 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 481 amino acids
Description : TRMT13 (TRNA Methyltransferase 13 Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include methyltransferase activity and tRNA methyltransferase activity.
Molecular Mass : 80.7 kDa
AA Sequence : MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAMEEEDARKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRMT13 tRNA methyltransferase 13 homolog [ Homo sapiens (human) ]
Official Symbol TRMT13
Synonyms TRMT13; tRNA methyltransferase 13 homolog; CCDC76; coiled-coil domain containing 76; tRNA guanosine-2-O-methyltransferase TRM13 homolog; FLJ10287; FLJ11219; tRNA [Gm4] methyltransferase; coiled-coil domain-containing protein 76;
Gene ID 54482
mRNA Refseq NM_019083
Protein Refseq NP_061956
UniProt ID Q9NUP7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRMT13 Products

Required fields are marked with *

My Review for All TRMT13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon