Recombinant Full Length Human TRMT13 Protein, GST-tagged

• Cat.No.: TRMT13-2882HF
• Product Overview: Human TRMT13 full-length ORF (NP_061956.1, 1 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 481 amino acids
• Description: TRMT13 (TRNA Methyltransferase 13 Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include methyltransferase activity and tRNA methyltransferase activity.
• Molecular Mass: 80.7 kDa
• AA Sequence: MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAMEEEDARKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRMT13 tRNA methyltransferase 13 homolog [ Homo sapiens (human) ]
• Official Symbol: TRMT13
• Synonyms: TRMT13; tRNA methyltransferase 13 homolog; CCDC76; coiled-coil domain containing 76; tRNA guanosine-2-O-methyltransferase TRM13 homolog; FLJ10287; FLJ11219; tRNA [Gm4] methyltransferase; coiled-coil domain-containing protein 76
• Gene ID: 54482
• mRNA Refseq: NM_019083
• Protein Refseq: NP_061956
• UniProt ID: Q9NUP7