Recombinant Full Length Human TRIM29 Protein, C-Flag-tagged
Cat.No. : | TRIM29-1194HFL |
Product Overview : | Recombinant Full Length Human TRIM29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transcriptional regulatory factor involved in carcinogenesis and/or differentiation. It may also function in the suppression of radiosensitivity since it is associated with ataxia telangiectasia phenotype. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALF AGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTV SIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRD HQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQL KIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSP GRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTW KSGKQTMLSHYRPFYVNKGNGIGSNEAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | TRIM29 tripartite motif containing 29 [ Homo sapiens (human) ] |
Official Symbol | TRIM29 |
Synonyms | ATDC |
Gene ID | 23650 |
mRNA Refseq | NM_012101.4 |
Protein Refseq | NP_036233.2 |
MIM | 610658 |
UniProt ID | Q14134 |
◆ Recombinant Proteins | ||
YVLD-3144B | Recombinant Bacillus subtilis YVLD protein, His-tagged | +Inquiry |
COX5A-1210R | Recombinant Rat COX5A Protein, His (Fc)-Avi-tagged | +Inquiry |
Kctd5-3674M | Recombinant Mouse Kctd5 Protein, Myc/DDK-tagged | +Inquiry |
SAP085A-003-2663S | Recombinant Staphylococcus aureus (strain: SK1396, other: Tc) SAP085A_003 protein, His-tagged | +Inquiry |
SAP30L-3891R | Recombinant Rhesus Macaque SAP30L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOHH-505HCL | Recombinant Human DOHH cell lysate | +Inquiry |
GAMT-684HCL | Recombinant Human GAMT cell lysate | +Inquiry |
T-47D-2138H | T-47D (human breast duct carinoma) nuclear extract lysate | +Inquiry |
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
RASL11B-2501HCL | Recombinant Human RASL11B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM29 Products
Required fields are marked with *
My Review for All TRIM29 Products
Required fields are marked with *
0
Inquiry Basket