Recombinant Full Length Human Transmembrane Protein 62(Tmem62) Protein, His-Tagged
Cat.No. : | RFL12075HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 62(TMEM62) Protein (Q0P6H9) (1-643aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-643) |
Form : | Lyophilized powder |
AA Sequence : | MAAVLALRVVAGLAAAALVAMLLEHYGLAGQPSPLPRPAPPRRPHPAPGPGDSNIFWGLQ ISDIHLSRFRDPGRAVDLEKFCSETIDIIQPALVLATGDLTDAKTKEQLGSRQHEVEWQT YQGILKKTRVMEKTKWLDIKGNHDAFNIPSLDSIKNYYRKYSAVRRDGSFHYVHSTPFGN YSFICVDATVNPGPKRPYNFFGILDKKKMEELLLLAKESSRSNHTIWFGHFTTSTILSPS PGIRSIMSSAIAYLCGHLHTLGGLMPVLHTRHFQGTLELEVGDWKDNRRYRIFAFDHDLF SFADLIFGKWPVVLITNPKSLLYSCGEHEPLERLLHSTHIRVLAFSLSSITSVTVKIDGV HLGQAVHVSGPIFVLKWNPRNYSSGTHNIEVIVQDSAGRSKSVHHIFSVQENNHLSFDPL ASFILRTDHYIMARVLFVLIVLSQLTILIIFRYRGYPELKEPSGFINLTSFSLHVLSKIN IFYYSVLLLTLYTVLGPWFFGEIIDGKFGCCFSFGIFVNGHFLQGSITFIIGILQLAFFN IPLMAYMCWSLLQRCFGHNFRSHLHQRKYLKIMPVHLLMLLLYIWQVYSCYFLYATYGTL AFLFSPLRTWLTLLTPVLIRYVWTLNSTKFGIFMVQLKSHLSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM62 |
Synonyms | TMEM62; Transmembrane protein 62 |
UniProt ID | Q0P6H9 |
◆ Recombinant Proteins | ||
DAP3-2199M | Recombinant Mouse DAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCN2-001H | Recombinant Human LCN2 Protein, GST-tagged | +Inquiry |
RFL22587SF | Recombinant Full Length Salmonella Paratyphi A Protoheme Ix Farnesyltransferase(Cyoe) Protein, His-Tagged | +Inquiry |
CCDC177-2874M | Recombinant Mouse CCDC177 Protein | +Inquiry |
FAM3D-3756H | Recombinant Human FAM3D Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-150R | Active Native Rat Arginase | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX58-7000HCL | Recombinant Human DDX58 293 Cell Lysate | +Inquiry |
TBCE-1216HCL | Recombinant Human TBCE 293 Cell Lysate | +Inquiry |
HLA-A-5503HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
TEX12-663HCL | Recombinant Human TEX12 lysate | +Inquiry |
DIS3-6919HCL | Recombinant Human DIS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM62 Products
Required fields are marked with *
My Review for All TMEM62 Products
Required fields are marked with *
0
Inquiry Basket