Recombinant Full Length Human Transmembrane Protein 55B(Tmem55B) Protein, His-Tagged
Cat.No. : | RFL2153HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 55B(TMEM55B) Protein (Q86T03) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVL PGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGK KYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNT FLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRY GGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PIP4P1 |
Synonyms | PIP4P1; C14orf9; TMEM55B; Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 1 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase I; Transmembrane protein 55B |
UniProt ID | Q86T03 |
◆ Native Proteins | ||
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
Lectin-1725W | Native Wheat Germ Lectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAX2-2491HCL | Recombinant Human RAX2 293 Cell Lysate | +Inquiry |
S100A11-2095HCL | Recombinant Human S100A11 293 Cell Lysate | +Inquiry |
K562-01HL | Human K562 lysate | +Inquiry |
ADAM8-855CCL | Recombinant Cynomolgus ADAM8 cell lysate | +Inquiry |
PEG3-3305HCL | Recombinant Human PEG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PIP4P1 Products
Required fields are marked with *
My Review for All PIP4P1 Products
Required fields are marked with *
0
Inquiry Basket