Recombinant Full Length Human Transmembrane Protein 44(Tmem44) Protein, His-Tagged
Cat.No. : | RFL2391HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 44(TMEM44) Protein (Q2T9K0) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MGEAPSPAPALWDWDYLDRCFARHRVCISFGLWICASSCWIAAHALLLYLRCAQKPRQDQ SALCAACCLLTSLCDTVGALLARQLTIQVFTGAYLAAIDLVNFMFILFPVCGSKFKSNSD REARERKRRRQLRASVFALALPLSLGPCWALWVAVPKASATIRGPQRRLLASLLQENTEI LGYLLGSVAAFGSWASRIPPLSRIAPPPTLGITTQHEIWRGQMSKPSQSPSRSPSGHWRA AAQRQVLGTEMCRGKTFPSIHLWTRLLSALAGLLYASAIVAHDQHPEYLLRATPWFLTSL GRAALDLAIIFLSCVMKSKMRQALGFAKEARESPDTQALLTCAEKEEENQENLDWVPLTT LSHCKSLRTMTAISRYMELTIEPVQQAGCSATRLPGDGQTSAGDASLQDPPSYPPVQVIR ARVSSGSSSEVSSINSDLEWDPEDVNLEGSKENVELLGSQVHQDSVRTAHLSDDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM44 |
Synonyms | DKFZp686O18124; TMEM44; TMM44_HUMAN; Transmembrane protein 44 |
UniProt ID | Q2T9K0 |
◆ Recombinant Proteins | ||
MAPT-140H | Recombinant Human Tau-441 (S198E) | +Inquiry |
NDP-10502M | Recombinant Mouse NDP Protein | +Inquiry |
UQCRQ-2323H | Recombinant Human UQCRQ protein, His-tagged | +Inquiry |
ZNF238-5125R | Recombinant Rhesus Macaque ZNF238 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14576RF | Recombinant Full Length Rat Furin(Furin) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCRS1-4411HCL | Recombinant Human MCRS1 293 Cell Lysate | +Inquiry |
SPACA4-1551HCL | Recombinant Human SPACA4 293 Cell Lysate | +Inquiry |
GPRC5A-5771HCL | Recombinant Human GPRC5A 293 Cell Lysate | +Inquiry |
PRPF4-2825HCL | Recombinant Human PRPF4 293 Cell Lysate | +Inquiry |
PPIL6-2965HCL | Recombinant Human PPIL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM44 Products
Required fields are marked with *
My Review for All TMEM44 Products
Required fields are marked with *
0
Inquiry Basket