Recombinant Full Length Human Transmembrane Protein 200C(Tmem200C) Protein, His-Tagged
Cat.No. : | RFL18997HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 200C(TMEM200C) Protein (A6NKL6) (1-621aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-621) |
Form : | Lyophilized powder |
AA Sequence : | MIATGGLLRISARKQDPLRPPSQIPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGI LVLLVGIAMAVVGYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAP GGVNSSSAGAPRSTPPARAASPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLF ICANAVLHENRDKKTKIINLRDLYSTVIDVHSLRAKDLAAAAAAAAAAAASSSSSAPAAA PPGAIPLNGFLSYVQSRGLELKPGGCGGSGDAFGAAAMLAKGSWPPHPAAPSGGRPRGAA SPPDLASSPRCPREPPSLAEAVYSVYRERSGVAGSRRAAAATAAAAASSCSSPAPCSPPE SWGRQSTASSFVDSSLSAFALLPLQGGRDRGGDAEGASCSWQRPPGERGSQEIPRGELDL SMTNLRGAEGSMRGARREPEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRA PPSPEPPPSPGSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPL REAGTSTESVLDAVAGQTRDSAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQRQFTNKEK LIMISRSHAIGVEEELESTGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM200C |
Synonyms | TMEM200C; TTMA; Transmembrane protein 200C; Transmembrane protein TTMA; Two transmembrane domain-containing family member A |
UniProt ID | A6NKL6 |
◆ Recombinant Proteins | ||
Tesc-6361M | Recombinant Mouse Tesc Protein, Myc/DDK-tagged | +Inquiry |
RFL26886CF | Recombinant Full Length Cytophaga Hutchinsonii Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
CCL2-500HB | Recombinant Human CCL2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
INPP5J-2741H | Recombinant Human INPP5J Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NLK-1306H | Recombinant Human NLK, His-tagged | +Inquiry |
◆ Native Proteins | ||
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB2-936HCL | Recombinant Human EFNB2 cell lysate | +Inquiry |
OSBPL7-3532HCL | Recombinant Human OSBPL7 293 Cell Lysate | +Inquiry |
SH3BP1-1872HCL | Recombinant Human SH3BP1 293 Cell Lysate | +Inquiry |
PYCARD-2648HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
COPS8-7352HCL | Recombinant Human COPS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM200C Products
Required fields are marked with *
My Review for All TMEM200C Products
Required fields are marked with *
0
Inquiry Basket