Recombinant Full Length Human Transmembrane Protein 19(Tmem19) Protein, His-Tagged
Cat.No. : | RFL28307HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 19(TMEM19) Protein (Q96HH6) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVV PVLIVSNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKR LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL ACSAGDTWASEVGPVLSKSSPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNKAR HIAGKPILDNNAVNLFSSVLIALLLPTAAWGFWPRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM19 |
Synonyms | TMEM19; Transmembrane protein 19 |
UniProt ID | Q96HH6 |
◆ Recombinant Proteins | ||
VTN-4507H | Recombinant Human VTN Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPIN-606H | Recombinant Human ARPIN Protein, MYC/DDK-tagged | +Inquiry |
NQO1-001H | Active Recombinant Human NQO1 Protein | +Inquiry |
TENT5C-2174H | Recombinant Human TENT5C Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAE-1193M | Recombinant Mouse YWHAE, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAPGEFL1-2519HCL | Recombinant Human RAPGEFL1 293 Cell Lysate | +Inquiry |
DDX41-7005HCL | Recombinant Human DDX41 293 Cell Lysate | +Inquiry |
TRAF2-824HCL | Recombinant Human TRAF2 293 Cell Lysate | +Inquiry |
TULP4-637HCL | Recombinant Human TULP4 293 Cell Lysate | +Inquiry |
PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM19 Products
Required fields are marked with *
My Review for All TMEM19 Products
Required fields are marked with *
0
Inquiry Basket