Recombinant Full Length Human Transmembrane Protein 171(Tmem171) Protein, His-Tagged
Cat.No. : | RFL12872HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 171(TMEM171) Protein (Q8WVE6) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | MSPAAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLK VAGPACAVVGLGAVILARSRAQLQLRAGLQRGQQMDPDRAFICGESRQFAQCLIFGFLFL TSGMLISVLGIWVPGCGSNWAQEPLNETDTGDSEPRMCGFLSLQIMGPLIVLVGLCFFVV AHVKKRNTLNAGQDASEREEGQIQIMEPVQVTVGDSVIIFPPPPPPYFPESSASAVAESP GTNSLLPNENPPSYYSIFNYGRTPTSEGAASERDCESIYTISGTNSSSEASHTPHLPSEL PPRYEEKENAAATFLPLSSEPSPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM171 |
Synonyms | TMEM171; Transmembrane protein 171 |
UniProt ID | Q8WVE6 |
◆ Recombinant Proteins | ||
BSDC1-2506M | Recombinant Mouse BSDC1 Protein | +Inquiry |
MRPL34-2663R | Recombinant Rhesus Macaque MRPL34 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF3IP3-4933R | Recombinant Rhesus monkey TRAF3IP3 Protein, His-tagged | +Inquiry |
Tnfrsf17-1708M | Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 | +Inquiry |
KLHL36-8727M | Recombinant Mouse KLHL36 Protein | +Inquiry |
◆ Native Proteins | ||
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDELR2-5000HCL | Recombinant Human KDELR2 293 Cell Lysate | +Inquiry |
AMY2A-001CCL | Recombinant Cynomolgus AMY2A cell lysate | +Inquiry |
SEMA4D-2088MCL | Recombinant Mouse SEMA4D cell lysate | +Inquiry |
HA-2263HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
PTPRA-503HCL | Recombinant Human PTPRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM171 Products
Required fields are marked with *
My Review for All TMEM171 Products
Required fields are marked with *
0
Inquiry Basket