Recombinant Full Length Bovine Transmembrane Protein 171(Tmem171) Protein, His-Tagged
Cat.No. : | RFL28310BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 171(TMEM171) Protein (Q58DS4) (1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-326) |
Form : | Lyophilized powder |
AA Sequence : | MSPAAAAEPDGVRGDRHVSKLIFFLFVIGAILLCVGVLLSIFGFQACQYKTFPDCSMMLK IAGPACAVVGLGAVILARSRARLQQTEERLRGNNQADSDRPFLCGESRQFVQCLIFGFLF LTSGMLISVLGIWVPGCGSDWMQESLNETDTADSEPQICGFLSLQILGPLIVLVGLCFFV VAHVKKRSNLNGDQDASESEERQTQSLEPIQVTVGDAVIIFPPPPPPYFPESSASAAARS PGTDGLLPDESPPSYYSIFQSGSPTPEGQGAASERDCELIYTISGTASSSETSHTLHLLS ELPPRYEEKETATTTSLSPSSEPSPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM171 |
Synonyms | TMEM171; Transmembrane protein 171 |
UniProt ID | Q58DS4 |
◆ Recombinant Proteins | ||
LGSN-560H | Recombinant Human LGSN, His-tagged | +Inquiry |
RFL28894DF | Recombinant Full Length Desulfovibrio Magneticus Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
EPB41L4B-4263HF | Recombinant Full Length Human EPB41L4B Protein, GST-tagged | +Inquiry |
TPST2-2022C | Recombinant Chicken TPST2 | +Inquiry |
CFL1-0152H | Recombinant Human CFL1 Protein (M1-L166), His/Step tagged | +Inquiry |
◆ Native Proteins | ||
Protein C-89H | Native Human Protein C | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
REPIN1-2420HCL | Recombinant Human REPIN1 293 Cell Lysate | +Inquiry |
CHAF1A-7548HCL | Recombinant Human CHAF1A 293 Cell Lysate | +Inquiry |
PDE4A-3352HCL | Recombinant Human PDE4A 293 Cell Lysate | +Inquiry |
AXIN2-8554HCL | Recombinant Human AXIN2 293 Cell Lysate | +Inquiry |
NR1H3-3720HCL | Recombinant Human NR1H3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM171 Products
Required fields are marked with *
My Review for All TMEM171 Products
Required fields are marked with *
0
Inquiry Basket