Recombinant Full Length Human Transmembrane Anterior Posterior Transformation Protein 1 Homolog(Tapt1) Protein, His-Tagged
Cat.No. : | RFL9746HF |
Product Overview : | Recombinant Full Length Human Transmembrane anterior posterior transformation protein 1 homolog(TAPT1) Protein (Q6NXT6) (2-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-567) |
Form : | Lyophilized powder |
AA Sequence : | AGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRER RRGRTELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLD AFLYVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDY SMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPH FFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQ MSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFIT KFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSI KVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPSS KSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDN SELKHRSSKKDLLEIDRFTICGNRID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TAPT1 |
Synonyms | TAPT1; CMVFR; Transmembrane anterior posterior transformation protein 1 homolog; Cytomegalovirus partial fusion receptor |
UniProt ID | Q6NXT6 |
◆ Recombinant Proteins | ||
GKN1-5363H | Recombinant Human GKN1 protein, His&Myc-tagged | +Inquiry |
MAP3K11-3564R | Recombinant Rat MAP3K11 Protein | +Inquiry |
RMDN3-046H | Recombinant Human RMDN3 Protein, GST-HIS-tagged | +Inquiry |
OTUD5-6437M | Recombinant Mouse OTUD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD160-113CAF488 | Recombinant Monkey CD160 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFYVE28-1981HCL | Recombinant Human ZFYVE28 cell lysate | +Inquiry |
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
LYSMD2-1043HCL | Recombinant Human LYSMD2 cell lysate | +Inquiry |
EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAPT1 Products
Required fields are marked with *
My Review for All TAPT1 Products
Required fields are marked with *
0
Inquiry Basket