Recombinant Full Length Human Translocating Chain-Associated Membrane Protein 2(Tram2) Protein, His-Tagged
Cat.No. : | RFL6151HF |
Product Overview : | Recombinant Full Length Human Translocating chain-associated membrane protein 2(TRAM2) Protein (Q15035) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPT ADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKISKRLHLSKVKHSKFNESGQL VVFHFTSVIWCFYVVVTEGYLTNPRSLWEDYPHVHLPFQVKFFYLCQLAYWLHALPELYF QKVRKEEIPRQLQYICLYLVHIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADEN NEKLFSAWAAVFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGT SPRTKKLKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRAM2 |
Synonyms | TRAM2; KIAA0057; Translocating chain-associated membrane protein 2 |
UniProt ID | Q15035 |
◆ Native Proteins | ||
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
CRP-8374H | Native Human CRP | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
GINS2-5933HCL | Recombinant Human GINS2 293 Cell Lysate | +Inquiry |
C15orf48-8263HCL | Recombinant Human C15orf48 293 Cell Lysate | +Inquiry |
Skeletal Muscle-437R | Rhesus monkey Skeletal Muscle Membrane Lysate | +Inquiry |
DOK3-506HCL | Recombinant Human DOK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TRAM2 Products
Required fields are marked with *
My Review for All TRAM2 Products
Required fields are marked with *
0
Inquiry Basket