Recombinant Full Length Human TRAF2 Protein, C-Flag-tagged
Cat.No. : | TRAF2-1764HFL |
Product Overview : | Recombinant Full Length Human TRAF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from members of the TNF receptor superfamily. This protein directly interacts with TNF receptors, and forms a heterodimeric complex with TRAF1. This protein is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF1 interacts with the inhibitor-of-apoptosis proteins (IAPs), and functions as a mediator of the anti-apoptotic signals from TNF receptors. The interaction of this protein with TRADD, a TNF receptor associated apoptotic signal transducer, ensures the recruitment of IAPs for the direct inhibition of caspase activation. BIRC2/c-IAP1, an apoptosis inhibitor possessing ubiquitin ligase activity, can unbiquitinate and induce the degradation of this protein, and thus potentiate TNF-induced apoptosis. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of only one transcript has been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCA ACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACK GLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCG KCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTA TFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTY DGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAI FIKAIVDLTGL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adipocytokine signaling pathway, Apoptosis, MAPK signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | TRAF2 TNF receptor associated factor 2 [ Homo sapiens (human) ] |
Official Symbol | TRAF2 |
Synonyms | TRAP; TRAP3; RNF117; MGC:45012 |
Gene ID | 7186 |
mRNA Refseq | NM_021138.4 |
Protein Refseq | NP_066961.2 |
MIM | 601895 |
UniProt ID | Q12933 |
◆ Recombinant Proteins | ||
TRAF2-2248H | Recombinant Human TRAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF2-4745R | Recombinant Rhesus Macaque TRAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF2-17284M | Recombinant Mouse TRAF2 Protein | +Inquiry |
Traf2-6617M | Recombinant Mouse Traf2 Protein, Myc/DDK-tagged | +Inquiry |
TRAF2-9556M | Recombinant Mouse TRAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF2-824HCL | Recombinant Human TRAF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRAF2 Products
Required fields are marked with *
My Review for All TRAF2 Products
Required fields are marked with *
0
Inquiry Basket