Recombinant Full Length Human TRA2B Protein, C-Flag-tagged
Cat.No. : | TRA2B-1380HFL |
Product Overview : | Recombinant Full Length Human TRA2B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS RSYSPRRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | TRA2B transformer 2 beta homolog [ Homo sapiens (human) ] |
Official Symbol | TRA2B |
Synonyms | SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta |
Gene ID | 6434 |
mRNA Refseq | NM_004593.3 |
Protein Refseq | NP_004584.1 |
MIM | 602719 |
UniProt ID | P62995 |
◆ Recombinant Proteins | ||
TRA2B-5911R | Recombinant Rat TRA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TRA2B-6244C | Recombinant Chicken TRA2B | +Inquiry |
TRA2B-9553M | Recombinant Mouse TRA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TRA2B-6254R | Recombinant Rat TRA2B Protein | +Inquiry |
TRA2B-4929R | Recombinant Rhesus monkey TRA2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRA2B Products
Required fields are marked with *
My Review for All TRA2B Products
Required fields are marked with *
0
Inquiry Basket