Recombinant Full Length Human TPD52L3 Protein, GST-tagged

Cat.No. : TPD52L3-6876HF
Product Overview : Human TPD52L3 full-length ORF ( NP_277051.3, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 140 amino acids
Description : This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternate splicing results in multiple transcript variants.
Molecular Mass : 41.9 kDa
AA Sequence : MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGLMGTIKSKVSGGKRAWP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TPD52L3 TPD52 like 3 [ Homo sapiens (human) ]
Official Symbol TPD52L3
Synonyms TPD52L3; TPD52 like 3; D55; hD55; TPD55; NYDSP25; tumor protein D55; protein kinase NYD-SP25; testis development protein NYD-SP25; testis tissue sperm-binding protein Li 87P; tumor protein D52 like 3
Gene ID 89882
mRNA Refseq NM_033516
Protein Refseq NP_277051
MIM 617567
UniProt ID Q96J77

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TPD52L3 Products

Required fields are marked with *

My Review for All TPD52L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon