Recombinant Full Length Human TOR4A Protein, GST-tagged
Cat.No. : | TOR4A-3547HF |
Product Overview : | Human C9orf167 full-length ORF (BAA91032.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 423 amino acids |
Description : | TOR4A (Torsin Family 4 Member A) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. An important paralog of this gene is TOR3A. |
Molecular Mass : | 73.3 kDa |
AA Sequence : | MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYLATHVHSRPLLLALYGPSGVGKSHVGRLLARHFRSVLEDSALVLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWRAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAVTGCKQVVATVNLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TOR4A torsin family 4, member A [ Homo sapiens ] |
Official Symbol | TOR4A |
Synonyms | C9orf167; RP13-122B23.4 |
Gene ID | 54863 |
mRNA Refseq | NM_017723 |
Protein Refseq | NP_060193 |
UniProt ID | Q9NXH8 |
◆ Recombinant Proteins | ||
TIGIT-732R | Recombinant Rabbit TIGIT Protein, Fc-tagged | +Inquiry |
Gja5-6995R | Recombinant Rat Gja5 protein, His-tagged | +Inquiry |
MAPK11-373H | Recombinant Human MAPK11, GST-tagged, Active | +Inquiry |
KDR-236HP | Recombinant Human KDR protein, Fc-tagged, R-PE labeled | +Inquiry |
IRF7-897H | Recombinant Human IRF7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-509H | Human Testis Liver Cirrhosis Lysate | +Inquiry |
FDX1L-6269HCL | Recombinant Human FDX1L 293 Cell Lysate | +Inquiry |
TEX12-663HCL | Recombinant Human TEX12 lysate | +Inquiry |
HTR3C-5333HCL | Recombinant Human HTR3C 293 Cell Lysate | +Inquiry |
CALR3-7884HCL | Recombinant Human CALR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOR4A Products
Required fields are marked with *
My Review for All TOR4A Products
Required fields are marked with *
0
Inquiry Basket