Recombinant Full Length Human TNFSF18 Protein, C-Flag-tagged
Cat.No. : | TNFSF18-1491HFL |
Product Overview : | Recombinant Full Length Human TNFSF18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQ MASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTY ELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | TNFSF18 TNF superfamily member 18 [ Homo sapiens (human) ] |
Official Symbol | TNFSF18 |
Synonyms | TL6; AITRL; GITRL; TNLG2A; hGITRL |
Gene ID | 8995 |
mRNA Refseq | NM_005092.4 |
Protein Refseq | NP_005083.3 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
TNFSF18-640H | Recombinant Human TNFSF18 Protein (Glu52-Ser177), His-tagged | +Inquiry |
TNFSF18-37H | Recombinant Human TNFSF18 protein, Fc-tagged | +Inquiry |
TNFSF18-30485TH | Recombinant Human TNFSF18, His-tagged | +Inquiry |
Tnfsf18-2130M | Recombinant Mouse Tnfsf18, His-tagged | +Inquiry |
TNFSF18-2564H | Recombinant Human TNFSF18, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *
0
Inquiry Basket