Recombinant Full Length Human TNFSF18 Protein, C-Flag-tagged
Cat.No. : | TNFSF18-1491HFL |
Product Overview : | Recombinant Full Length Human TNFSF18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQ MASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTY ELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | TNFSF18 TNF superfamily member 18 [ Homo sapiens (human) ] |
Official Symbol | TNFSF18 |
Synonyms | TL6; AITRL; GITRL; TNLG2A; hGITRL |
Gene ID | 8995 |
mRNA Refseq | NM_005092.4 |
Protein Refseq | NP_005083.3 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
MS4A1-10H | Recombinant Human MS4A1, GST-tagged | +Inquiry |
ALB-268R | Recombinant Rat ALB Protein, His (Fc)-Avi-tagged | +Inquiry |
ANAPC15 -471H | Recombinant Human ANAPC15 Protein, GST-tagged | +Inquiry |
CARD16-1950HF | Recombinant Full Length Human CARD16 Protein, GST-tagged | +Inquiry |
DNAJB12-2732H | Recombinant Human DNAJB12 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
LDL-400H | Native Human Low Density Lipoprotein, High Oxidized | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf68-8338HCL | Recombinant Human C11orf68 293 Cell Lysate | +Inquiry |
UBE2F-719HCL | Recombinant Human UBE2F lysate | +Inquiry |
HOMER1-806HCL | Recombinant Human HOMER1 cell lysate | +Inquiry |
RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
ISL2-876HCL | Recombinant Human ISL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *
0
Inquiry Basket