Recombinant Full Length Human TNFRSF14 Protein, C-Flag-tagged
Cat.No. : | TNFRSF14-928HFL |
Product Overview : | Recombinant Full Length Human TNFRSF14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MEPPGDWGPPPWRSTPRTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGEL TGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA YATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSL VIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRS PNHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | TNFRSF14 TNF receptor superfamily member 14 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF14 |
Synonyms | TR2; ATAR; HVEA; HVEM; CD270; LIGHTR |
Gene ID | 8764 |
mRNA Refseq | NM_003820.4 |
Protein Refseq | NP_003811.2 |
MIM | 602746 |
UniProt ID | Q92956 |
◆ Recombinant Proteins | ||
TNFRSF14-670H | Recombinant Human TNFRSF14 Protein, Fc-tagged | +Inquiry |
TNFRSF14-2443H | Recombinant human TNFRSF14, His-tagged | +Inquiry |
TNFRSF14-878H | Active Recombinant Human TNFRSF14 Protein, Fc-tagged | +Inquiry |
TNFRSF14-555HAF647 | Recombinant Human TNFRSF14 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFRSF14-555H | Recombinant Human TNFRSF14 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *
0
Inquiry Basket