Recombinant Full Length Human TMX4 Protein, C-Myc/DDK-tagged

• Cat.No.: TMX4-13HFL
• Product Overview: Recombinant Full Length Human TMX4 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T.

Specification

• Description: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and C-terminal ASP/GLU-rich calcium binding domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The encoded protein has been shown to have reductase activity in vitro.
• Source: HEK293T
• Species: Human
• Tag: Myc&DDK
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
• Molecular Mass: 38.8 kDa
• AA Sequence: MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQT DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKW QSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVI SECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEE EEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >0.05 µg/µL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: TMX4 thioredoxin related transmembrane protein 4 [ Homo sapiens (human) ]
• Official Symbol: TMX4
• Synonyms: PDIA14; TXNDC13; DJ971N18.2
• Gene ID: 56255
• mRNA Refseq: NM_021156.4
• Protein Refseq: NP_066979.2
• MIM: 616766
• UniProt ID: Q9H1E5