Recombinant Full Length Human TMX4 Protein, C-Myc/DDK-tagged
Cat.No. : | TMX4-13HFL |
Product Overview : | Recombinant Full Length Human TMX4 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and C-terminal ASP/GLU-rich calcium binding domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The encoded protein has been shown to have reductase activity in vitro. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQT DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKW QSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVI SECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEE EEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 µg/µL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | TMX4 thioredoxin related transmembrane protein 4 [ Homo sapiens (human) ] |
Official Symbol | TMX4 |
Synonyms | PDIA14; TXNDC13; DJ971N18.2 |
Gene ID | 56255 |
mRNA Refseq | NM_021156.4 |
Protein Refseq | NP_066979.2 |
MIM | 616766 |
UniProt ID | Q9H1E5 |
◆ Recombinant Proteins | ||
TMX4-4673R | Recombinant Rhesus Macaque TMX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMX4-13HFL | Recombinant Full Length Human TMX4 Protein, C-Myc/DDK-tagged | +Inquiry |
Tmx4-6537M | Recombinant Mouse Tmx4 Protein, Myc/DDK-tagged | +Inquiry |
RFL21154MF | Recombinant Full Length Mouse Thioredoxin-Related Transmembrane Protein 4(Tmx4) Protein, His-Tagged | +Inquiry |
TMX4-3269Z | Recombinant Zebrafish TMX4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMX4-898HCL | Recombinant Human TMX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMX4 Products
Required fields are marked with *
My Review for All TMX4 Products
Required fields are marked with *
0
Inquiry Basket