Recombinant Full Length Human TMOD4 Protein, C-Flag-tagged
Cat.No. : | TMOD4-2166HFL |
Product Overview : | Recombinant Full Length Human TMOD4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable tropomyosin binding activity. Predicted to be involved in actin filament organization; muscle contraction; and myofibril assembly. Located in striated muscle thin filament. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQ YLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTL MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPI PMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENA TLTELRVDNQRQWPGDAVEMEMATVLEQRPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TMOD4 tropomodulin 4 [ Homo sapiens (human) ] |
Official Symbol | TMOD4 |
Synonyms | SK-TMOD |
Gene ID | 29765 |
mRNA Refseq | NM_013353.3 |
Protein Refseq | NP_037485.2 |
MIM | 605834 |
UniProt ID | Q9NZQ9 |
◆ Recombinant Proteins | ||
TMOD4-6338C | Recombinant Chicken TMOD4 | +Inquiry |
Tmod4-6525M | Recombinant Mouse Tmod4 Protein, Myc/DDK-tagged | +Inquiry |
TMOD4-1900H | Recombinant Human TMOD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMOD4-2131H | Recombinant Human TMOD4 Protein (1-345 aa), GST-tagged | +Inquiry |
TMOD4-2213H | Recombinant Human TMOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMOD4-914HCL | Recombinant Human TMOD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMOD4 Products
Required fields are marked with *
My Review for All TMOD4 Products
Required fields are marked with *
0
Inquiry Basket