Recombinant Full Length Human TMEM25 Protein, C-Flag-tagged
Cat.No. : | TMEM25-1229HFL |
Product Overview : | Recombinant Full Length Human TMEM25 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in negative regulation of excitatory postsynaptic potential and regulation of protein stability. Predicted to be located in late endosome and lysosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL GYIYRVSSVSSDEIWLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | TMEM25 transmembrane protein 25 [ Homo sapiens (human) ] |
Official Symbol | TMEM25 |
Synonyms | FLJ14399 |
Gene ID | 84866 |
mRNA Refseq | NM_032780.4 |
Protein Refseq | NP_116169.2 |
MIM | 613934 |
UniProt ID | Q86YD3 |
◆ Recombinant Proteins | ||
TMEM25-541H | Recombinant Human TMEM25, His tagged | +Inquiry |
TMEM25-17024M | Recombinant Mouse TMEM25 Protein | +Inquiry |
TMEM25-2209H | Recombinant Human TMEM25 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM25-1229HFL | Recombinant Full Length Human TMEM25 Protein, C-Flag-tagged | +Inquiry |
Tmem25-6498M | Recombinant Mouse Tmem25 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM25-1125HCL | Recombinant Human TMEM25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM25 Products
Required fields are marked with *
My Review for All TMEM25 Products
Required fields are marked with *
0
Inquiry Basket