Recombinant Full Length Human TMEM159 Protein, GST-tagged

• Cat.No.: TMEM159-5908HF
• Product Overview: Human LOC57146 full-length ORF ( NP_065155.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 161 amino acids
• Description: TMEM159 (Transmembrane Protein 159) is a Protein Coding gene.
• Molecular Mass: 43.9 kDa
• AA Sequence: MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSADFEGLYQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM159 transmembrane protein 159 [ Homo sapiens ]
• Official Symbol: TMEM159
• Synonyms: PROMETHIN; TMEM159; transmembrane protein 159
• Gene ID: 57146
• mRNA Refseq: NM_020422
• Protein Refseq: NP_065155
• MIM: 611304
• UniProt ID: Q96B96