Recombinant Full Length Human TMEM159 Protein, GST-tagged
Cat.No. : | TMEM159-5908HF |
Product Overview : | Human LOC57146 full-length ORF ( NP_065155.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 161 amino acids |
Description : | TMEM159 (Transmembrane Protein 159) is a Protein Coding gene. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSADFEGLYQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM159 transmembrane protein 159 [ Homo sapiens ] |
Official Symbol | TMEM159 |
Synonyms | PROMETHIN; TMEM159; transmembrane protein 159 |
Gene ID | 57146 |
mRNA Refseq | NM_020422 |
Protein Refseq | NP_065155 |
MIM | 611304 |
UniProt ID | Q96B96 |
◆ Recombinant Proteins | ||
TMEM159-9312M | Recombinant Mouse TMEM159 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL993MF | Recombinant Full Length Mouse Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
TMEM159-301371H | Recombinant Human TMEM159 protein, GST-tagged | +Inquiry |
TMEM159-4769H | Recombinant Human TMEM159 Protein, GST-tagged | +Inquiry |
TMEM159-5908HF | Recombinant Full Length Human TMEM159 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM159 Products
Required fields are marked with *
My Review for All TMEM159 Products
Required fields are marked with *
0
Inquiry Basket