Recombinant Full Length Human TGFBI Protein, C-Flag-tagged
Cat.No. : | TGFBI-924HFL |
Product Overview : | Recombinant Full Length Human TGFBI Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.4 kDa |
AA Sequence : | MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNRKYFTNCKQWYQ RKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTI FAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIV TVNCARLLKADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAP TNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKA IISNKDILATNGVIHYIDELLIPDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVF KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGT LFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLG DAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITN VLQPPANRPQERGDELADSALEIFKQASAFSRASQRSVRLAPVYQKLLERMKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | TGFBI transforming growth factor beta induced [ Homo sapiens (human) ] |
Official Symbol | TGFBI |
Synonyms | CSD; CDB1; CDG2; CSD1; CSD2; CSD3; EBMD; LCD1; BIGH3; CDGG1 |
Gene ID | 7045 |
mRNA Refseq | NM_000358.3 |
Protein Refseq | NP_000349.1 |
MIM | 601692 |
UniProt ID | Q15582 |
◆ Recombinant Proteins | ||
Tgfbi-6391M | Recombinant Mouse Tgfbi Protein, Myc/DDK-tagged | +Inquiry |
TGFBI-6433H | Recombinant Human TGFBI Protein (Gly423-Leu632), His tagged | +Inquiry |
Tgfbi-621M | Active Recombinant Mouse Tgfbi Protein, His-tagged | +Inquiry |
TGFBI-211H | Active Recombinant Human TGFBI Protein, His-tagged | +Inquiry |
TGFBI-513H | Recombinant Human TGFBI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBI-2766HCL | Recombinant Human TGFBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBI Products
Required fields are marked with *
My Review for All TGFBI Products
Required fields are marked with *
0
Inquiry Basket